PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC09G11090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 379aa    MW: 40328.6 Da    PI: 9.7471
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC09G11090.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.91.1e-13300350555
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                      +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++ Nk+L  +  e+ ++
  OPUNC09G11090.1 300 RRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKEMNKELERKQAEIMEM 350
                      79************************************9998777766665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.5E-11296361IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.806298349IPR004827Basic-leucine zipper domain
CDDcd147073.29E-23300352No hitNo description
PfamPF001701.4E-11300351IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.0E-13300349No hitNo description
SuperFamilySSF579599.38E-10300348No hitNo description
PROSITE patternPS000360303318IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MLTDRWGGRR EAMEFRNGGS SSSERRPAAA EGATLARQGS VYSLTFDEFQ SALAGGGGGG  60
GGGGGSGFGK DFGSMNMDEL LRSIWTAEES QAMASASGSA AGVGVAVGAP PTSLQRQGSL  120
TLPRTLSAKT VDEVWRNLVR DEPPPVGAAD GGEIPPQRQS TLGEMTLEEF LVRAGVVREN  180
PPAAPHVPPP MPPRPVQVVP KTTAFLGNFP GANDAGAAAL GFAPLGMGDP ALGNGLMPRA  240
VPVGLPGAAV SMQAAVNQFD SGLDKGNSDL SSPTEPMPYS FEGLVRGRRN GGGVEKVVER  300
RQRRMIKNRE SAARSRARKQ AYTMELEAEV QKLKEMNKEL ERKQAEIMEM QKNEVEEMIK  360
DPFGRRKRLC LRRTLTGPW
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00087SELEXTransfer from AT1G49720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0658730.0AK065873.1 Oryza sativa Japonica Group cDNA clone:J013049N23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612550.10.0PREDICTED: bZIP transcription factor TRAB1-like
SwissprotQ6ZDF31e-103TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBLA0A0E0M2030.0A0A0E0M203_ORYPU; Uncharacterized protein
STRINGORGLA09G0097200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19290.28e-38ABRE binding factor 4